Dermazone StoreDermazone StoreDermazone Store

Coxir Brown Rice Ceramide Sunscreen - 50ml

ريال148.35

جميع الأسعار شاملة الضريبة

⦿ SPF 50+ for maximum protection against UVA and UVB rays
⦿ Infused with brown rice extract for deep skin nourishment and renewal
⦿ Contains ceramides and hyaluronic acid to hydrate and strengthen the skin barrier
⦿ Lightweight, non-greasy formula, suitable for all skin types including sensitive skin
⦿ Protects from environmental damage while reducing pigmentation and evening skin tone

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview 

Coxir's brown rice ceramide sunscreen provides SPF 50+ maximum protection against harmful sun rays while deeply nourishing the skin. This sunscreen contains hyaluronic acid, ceramides, and brown rice extract, working together to renew and protect the skin.

Coxir sunscreen effectively shields the skin from UVA and UVB rays, which are major contributors to pigmentation and premature aging. It is suitable for all skin types, including sensitive skin, thanks to its lightweight, non-greasy formula that doesn’t leave a sticky residue.

Product Details

  • Size: 50ml
  • Brand: Coxir
  • Country of Origin: Korea
  • Skin Type: All skin types

How to Use

  • Apply a generous amount of sunscreen 15 minutes before sun exposure.
  • Spread evenly on your face and neck.
  • Reapply every 2-3 hours for continued protection.

Key Ingredients

  • Brown Rice: Improves skin tone, promotes cell renewal, and provides deep nourishment.
  • Ceramides: Contain fatty acids that protect the skin’s barrier and offer intense hydration.
  • Hyaluronic Acid: Attracts and locks moisture in the skin, preventing dryness.
  • Beeswax: Moisturizes and protects the skin from pollutants without clogging pores.
  • Linoleic Acid: Enhances skin radiance and promotes healthy cell growth.
  • Camellia Seed Oil: Shields the skin from UV rays and helps to soothe wrinkles.
  • Hydrolyzed Collagen: Boosts skin elasticity and promotes the production of collagen and keratin for youthful skin.
  • Aloe Vera Extract: Improves skin texture with soothing and hydrating properties.
  • Fruit Extract: Packed with a blend of nourishing fruit oils for healthy skin.
  • Bergamot Oil: Softens the skin, tightens pores, and provides calming benefits.

Benefits

  • Reduces pigmentation and evens skin tone.
  • Offers maximum sun protection.
  • Shields the skin's outer layers from environmental damage.
  • Hydrates and nourishes the skin.

Warnings

  • For external use only.
  • Avoid contact with eyes.
  • Keep out of reach of children.
  • Discontinue use if irritation occurs.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Brown Rice Ceramide Sunscreen - 50ml

ريال148.35
تحدث الان