Dermazone StoreDermazone StoreDermazone Store

Coxir Green Tea pH Clear Foam Cleanser - 150 ml

ريال109.96

جميع الأسعار شاملة الضريبة

⦿ Green tea pH clear foam cleanser, to clean skin effectively
⦿ Balancing skin hydration and getting of dryness
⦿ Get of all skin dirts, makeup, and oils easily
⦿ All skin types
⦿ Rich in green tea to hydrate and soothes the skin
⦿ Cleaning pores deeply

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

We choose this light, creamy foaming cleanser for you; Because of its ability to deeply cleanse skin pores and effectively remove all dead skin cells to obtain radiant and clean skin through its ability to balance skin moisture.


This cleanser, with green tea extract and snail collagen, moisturizes the skin, removes makeup residue, removes deep impurities, and maintains the skin's moisture barrier. To protect it from dryness.


This moisturizer is characterized by containing the most important rich natural elements such as proteins, minerals and amino acids that remove active oxygen from the skin and thus provide antioxidants to maintain the skin’s youthfulness and radiance. It also soothes the skin and protects it from irritation signs.

Product Details

Product size: 150 ml

Brand: Coxir.

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Wash your face with lukewarm water, then use an appropriate amount of green tea cleanser all over your face.

  • Gently massage the face and continue massaging several times to clean the pores very well, then wash the face with lukewarm water.

Ingredients

  • Green Tea Extract: To protect and enhance the skin's moisture level in addition to soothing it.

  • Centella Asiatica Extract: maintains the balance of both moisture and oils in the skin.

  • Black Snail Collagen: maintains skin moisture and protects it from dryness, in addition to effectively improving skin elasticity.

  • Polyphenols: Fights signs of aging by reducing fine lines and wrinkles also improving skin texture.

Why Use Ultra Green Tea Cleanser

  • A light foaming cleanser that effectively cleanses the skin.

  • It contains antioxidant properties that protect the skin from damage.

  • Removes the toughest dirt and stuck oils.

  • Free of parabens, fragrances, alcohol and other harsh ingredients.

Warnings

  • For external use only.

  • Avoid contact with eyes.

  • Keep out of reach of children.

  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 1 review
0%
(0)
0%
(0)
100%
(1)
0%
(0)
0%
(0)
n
njoud saad

كوكسير غسول رغوي بالشاي الأخضر لرطوبة البشرة - 150 مل

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Green Tea pH Clear Foam Cleanser - 150 ml

ريال109.96
تحدث الان