Dermazone StoreDermazone StoreDermazone Store

Coxir Ultra Hyaluronic Acid Cleansing Oil - 150 ml

ريال159.99

جميع الأسعار شاملة الضريبة

⦿ Effectively removes makeup, dirt, and excess oil in one step.
⦿ Enriched with hyaluronic acid for intense moisture.
⦿ Suitable for all skin types, including sensitive and acne-prone skin.
⦿ Contains 19 herbal extracts and 100% natural oils for soothing and improving skin texture.

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Hyaluronic Acid Cleanser & Makeup Remover

Product Overview

A lightweight, non-greasy cleansing oil enriched with hyaluronic acid. This cleanser effectively removes makeup, oils, and dirt without causing dryness or irritation, leaving your skin feeling refreshed and hydrated.

The formula tackles blackheads and whiteheads, clearing out excess oil from pores while minimizing redness and irritation. Coxir's cleansing oil effectively removes make up in one application, eliminating the need for a second cleanse and ensuring no sticky residue is left behind. It's perfect for all skin types, including those prone to acne or dryness.

Product Details

  • Size: 150 ml
  • Brand: Coxir
  • Made in: Korea
  • Skin Type: All Skin Types

Instructions for Use

  1. Dispense an appropriate amount of cleansing oil into the dry palm of your hand.
  2. Gently massage the product all over your face.
  3. Rinse thoroughly with lukewarm water.

Key Ingredients

  • Hyaluronic Acid: Provides intense hydration to combat dryness.
  • 19 Herbal Extracts: Soothes and moisturizes while effectively dissolving oils.
  • 100% Natural Oils: Softens skin and enhances texture without irritating the eyes.

Why Choose Ultra Hyaluronic Cleansing Oil?

  • Effortlessly removes dirt and oils.
  • Eliminates makeup in a single use.
  • Cleanses impurities without leaving a sticky feel.

Warnings

  • For external use only.
  • Avoid contact with eyes.
  • Keep out of reach of children.
  • Discontinue use if irritation occurs.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 83 reviews
73%
(61)
7%
(6)
5%
(4)
2%
(2)
12%
(10)
S
Shams Alshemimry

كوكسير زيت تنظيف البشرة ألترا هيالورونيك

S
Suha Yousef

رائع

ف
فاطمة البارقي

كوكسير زيت تنظيف البشرة ألترا هيالورونيك

ه
هدب اللهيبي

كوكسير زيت تنظيف البشرة ألترا هيالورونيك

ف
فريال الرويلي

عادي جداً بس مزيل للمكياج ممتاز

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Ultra Hyaluronic Acid Cleansing Oil - 150 ml

ريال159.99
تحدث الان