Dermazone StoreDermazone StoreDermazone Store

I Dew Care Tap Secret Duo Dark Brown Mattifying Dry Shampoo Powder

ريال180.48

جميع الأسعار شاملة الضريبة

⦿ Includes two 7 g bottles for extended use
⦿ Promotes hydration and health for dark hair
⦿ Contains nourishing ingredients like black ginseng and Vitamin B3
⦿ Fine powder form for dark hair without residue
⦿ Portable and easy to apply with included sponge

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

The I Dew Care Tap Secret Duo Dark Brown Mattifying Dry Shampoo Powder includes two bottles designed for long-term use, promoting hair health and hydration while enhancing its appearance. This shampoo contains a variety of natural ingredients, including black ginseng and Vitamin B3.

The dry shampoo comes in a fine powder form specifically suited for dark hair, stored in a small container and accompanied by a soft sponge for precise application.

Product Details

  • Capacity: Two bottles, each 7 g

  • Brand: I Dew Care

  • Country of Origin: South Korea

  • Hair Type: Suitable for all dark hair types

Ingredients

  • Biotin: Promotes hair growth and thickness by nourishing the follicles.

  • Black Ginseng: Provides essential moisture and nutrition for healthy hair and scalp.

  • Charcoal Powder: Supports scalp health.

  • Betaine: Helps soothe the scalp.

How to Use

  1. Use the powder with the included applicator tool, applying it to the desired area 3-5 times and focusing on the roots.

  2. Remove excess powder with your fingertips and style hair as desired.

Usage Warnings

  • Discontinue use immediately if allergic reactions occur.

  • Consult a physician if symptoms worsen.

  • Avoid direct sunlight.

  • Keep away from the eyes.

  • Keep out of reach of children.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

I Dew Care Tap Secret Duo Dark Brown Mattifying Dry Shampoo Powder

ريال180.48
تحدث الان