Dermazone StoreDermazone StoreDermazone Store
بيع بالكامل

Watermans Hair Care Assist Bundle

ريال928.05

جميع الأسعار شاملة الضريبة

⦿ يحمي بروتيكت مي الشعر من حرارة أدوات التصفيف
⦿ يصلح ماسك مي تلف الشعر فيقاوم التقصّف والجفاف والتجعّد
⦿ يسد هير فايبرز فراغات الشعر بطريقة طبيعية بثبات قوي
⦿ يعزّز هير اويل ترطيب كلًا من الشعر والبشرة
⦿ تحسّن هذه المجموعة صحّة الشعر وتعزّز الترطيب واللمعان والقوة

اخبرني عندما يكون هذا المنتج هو متاح:

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Hair Care Bundle - Hair Moisturizing - Hair Damage Treatment - Filling Hair Spaces

Hair care Assist Bundle by Watermans

We have selected this unique hair care set for you, chosen by many celebrities; To treat damaged, dull, and brittle hair, protect it from the damages of blow-drying, heat styling tools, and other environmental factors, in addition to promoting hair hydration and growth, and giving a strong, effective, and fast solution to fill the hair gaps for the appearance of healthy, thick and shiny hair. This group includes the following:

Protect Me Heat Protection Spray - 200 ml

Protect Me Heat Protection Spray protects hair from the temperatures of styling tools and thus prevents split ends and frizz, and also contains natural substances such as caffeine and lupine protein, which promote hair growth at the same time, as it maintains hair moisture, protects hair color from fading, and fits All hair types, including dyed hair.

Mask Me- Hair Mask with Argan Oil - 200 ml

Watermans Hair Mask is rich in argan oil, treats hair damage, breakage and frizz. It also enhances hair moisture and shine, and nourishes the scalp; For strong and healthy hair growth, and is safe on all hair types, including dyed and color-prone hair; Because it is made of natural materials such as rosemary and argan oil, and free of harmful substances such as sulfates and parabens.

Hair Oyl for hair and skin - 60 ml

Watermans Hair and Body Oil enhances the moisture of both hair and skin, treats hair damage and improves its texture. This oil is also suitable for all types of hair, especially dry and curly hair, and increases hair luster. Because it contains natural ingredients such as camellia flower oil and black castor oil, which is free from any harmful chemicals.

Hair Thickening Fibers - 23 gm

Watermans Hair Fibers helps in filling hair gaps in an easy and fast way, revealing the hair with natural density; These fibers are suitable for all hair types and stick to it throughout the day until it is washed well with shampoo. Because it remains stable in all weather conditions, this fiber is suitable for both men and women, and it consists of natural materials.

How to use the products

The products can be used separately as needed, but we would like to help you apply the products in a way that ensures the best hair care results through the following steps:

  1. Use the mask after washing the hair, distribute it over the entire hair from the ends to the roots, wrap it with a towel or shower cap for at least 10 minutes and then rinse it off.
  2. Use either camellia flower oil after showering if you do not use any styling products, or use a protection spray after showering if you are going to hairdressing, and before going out.
  3. Use hair thickening fibers by shaking a few of them on the blanks, increasing as desired, and then waiting for 30 seconds; So it sticks well.

We have selected for you this group of hair care supplements; To facilitate the repair of damaged hair and protect it against harmful influences to get healthy and thick hair as soon as possible

Dermazone family wishes you good health and beauty

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

تحدث الان