Dermazone StoreDermazone StoreDermazone Store
بيع بالكامل

FINO PREMIUM TOUCH HAIR MASK - 230g

ريال108.00

جميع الأسعار شاملة الضريبة

  • Hair mask for hair protection and getting rid of damage
  • Extra care for damaged and dull hair
  • Contains royal jelly and other moisturizing elements
  • Recommended for dry and damaged hair
  • Restores hair health and shine within a short time from the start of use
  • Recommended by hair experts

اخبرني عندما يكون هذا المنتج هو متاح:

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Product Overview

We chose for you the Japanese hair mask Fino from Shiseido to eliminate and repair the most severe types of hair damage. It is designed with a property that goes deep into the hair to help treat hair from the inside out.


Fino mask specializes in eliminating damage resulting from:

  • Hair dying and treatment sessions.

  • Weather changes.

  • UV.

  • Blow drying and thermal styling tools.

Fino Hair Mask consists of royal jelly carefully blended with a range of highly moisturizing ingredients that penetrate deep into each hair cuticle to repair.

The formula of this mask is based on three main effects of repair, moisturizing and strengthening, and seven essential ingredients that help treat damage within a short period of use.

Product Details

Product size: 230g

Brand: Shiseido.

Made in: Japan.

Hair Type: Dry and Damaged Hair.

Instructions Of Use

  • Use the mask after washing your hair with shampoo and conditioner.

  • Apply an appropriate amount of mask on the hand.

  • Distribute the mask throughout the hair and massage gently.

  • Cover the hair with a shower cap, if available, and wait 5 minutes.

  • Rinse hair well with water.

Ingredients

  • Royal Jelly Extract: Rich in nutrients to repair hair damage and strengthen hair.

  • Wheat Protein: Protects hair from damage-causing agents and enhances shine.

  • Hydrogenated rapeseed oil: strengthens hair and reduces split ends and breakage.

  • Hydroxypropylarginine: Supports hair growth and strengthening.

Why Fino Hair Mask

  • Getting rid of severe hair damage.

  • Protecting hair from the heat of styling tools.

  • Restores hair strength and shine.

  • Rich in natural ingredients that are safe for hair.

Warnings

  • For external use only.

  • Avoid contact with eyes.

  • Keep out of reach of children.

  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 4 reviews
25%
(1)
25%
(1)
0%
(0)
0%
(0)
50%
(2)
K
Khadijah Muzayen

ماسك الشعر الياباني فينو

N
Nadia Khlaf

ماسك الشعر الياباني فينو

N
Nouf Otaibi

ماسك الشعر الياباني فينو

H
Hana Aljumayi

سيء جداً

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

تحدث الان