Dermazone StoreDermazone StoreDermazone Store
بيع بالكامل

Dermaceutic Hyal Ceutic 40 ml - Hydrating Cream

ريال373.20

جميع الأسعار شاملة الضريبة

Keeps the skin hydrated all day
Moisturizes and soothes the skin
Helps restore the skin after aesthetic procedures
Suitable for all skin types and ideal for oily skin
Prevents signs of skin aging

اخبرني عندما يكون هذا المنتج هو متاح:

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now
Details

Dermaceutic Hyal Ceutic 40 ml - Intense Hydrating Cream

Product Overview

Dermaceutic Hyal Ceutic is made up of an exclusive formula that combats changes in the skin and is able to sooth and restore the skin.

Hyal Ceutic provides essential nutrients to keep the skin hydrated all day. It also corrects deterioration in the properties of the dermis and in particular the reduction in hyaluronic acid, a natural component of the skin.

Why Hyal Ceutic?

  • Prevents signs of skin aging.

  • Keeps the skin hydrated all day.

  • Moisturizes and soothes the skin.

  • Suitable for all skin types and ideal for oily skin.

  • Free from fragrances and hypoallergenic.

Benefits of Dermaceutic Hyal Ceutic

  • The high content of hyaluronic acid moisturizes and repairs the skin.

  • Soothes and protects the skin.

  • Replenishes the skin.

  • Restores the natural moisture level of the skin.

  • Exclusive formula combats changes in the skin.

  • Helps moisturize the skin after aesthetic procedures

Product Information

Ingredients

MAIN INGREDIENTS:

5.5% Hyaluronic acid

High molecular weight hyaluronic acid gives Hyal Ceutic its protective and hygroscopic capacity, and low molecular weight hyaluronic acid, its repairing and relipidising properties. The low molecular weight penetrates skin deeply to ensure suppleness and firmness, and moisturizes the skin.

10% Aloe vera

Moisturizes and regenerates cells. Aloe vera soothes the skin, reduces inflammation, and stimulates production of collagen to combat skin aging.

2.5% Jojoba oil

Creates a non-oily moisturizing layer on the skin surface, relieves sensitive epidermises, and protects the skin from UV rays.

4% Vitamin E

Renowned for its antioxidant properties, vitamin E also combats the signs of photoaging.

Shea butter

Hydrating and nourishing agent that is highly concentrated in fatty acids and vitamins.

OTHER INGREDIENTS:

Water, Ethylhexyl palmitate, Sodium hyaluronate, Butyrospermum parkii, Hydrolysed soy protein, Triticum Vulgare (Wheat) germ oil, Isopropyl palmitate, Polyacrylamide/ C13-14 isoparaffin/Laurent, Simmondsia chinensis oil, DMDM hydantoin, Tocopheryl acetate

Instructions for use

  1. Apply Hyal Ceutic to the face, neck and around the eyes every morning as a moisturizing base or in the evening.

  2. Can be used as a "summer cream".

  3. Useful and a very popular moisturizer for men.

Warnings

  • Do not leave the product within the reach of children.

Product details

  • Pack Size: 40 ml

  • Age Group: 18+

  • Made In: France

  • Brand: Dermaceutic.

Clinical Test Results on Dermaceutic Hyal Ceutic

In Vivo study (independent clinical research organization) for the efficacy evaluation of Hyal Ceutic on 21 volunteers in combination with Activ Retinol and Foamer 15 for 28 days:

  • 91% of patients agreed that their skin feels replenished after using Hyal Ceutic.

In addition,to another study test on 10 volunteers, it resulted that Hyal Ceutic:

  • Effectively helps remove 99% of carbon particles from the skin's surface versus 69% on the area.

  • Provides a long-lasting moisturizing effect and increases hydration by 8.8% up to 24 hours after application.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 27 reviews
96%
(26)
4%
(1)
0%
(0)
0%
(0)
0%
(0)
ل
ليلي
🙏

احلللي مرطب هاي الهيال ☀️

ن
نجاح
👆👆

كنت عامله فيلر شفايف الدكتوره وصفته الي للبشره والشفايف بعد الفيلر فعلا جمييييل

ن
ناديه
ترطيبوشد

جربته ترطيب وشد للبشره مرررره ملمسه رائع مو مدهنن

S
Salma
👆

ترطيييييب ونضاره مو طبيعيه مع هاي الكريم جربووووه

ش
شذي
Star

دكتوري بالعياده حطو ليا بعد جلسه الفيلر حبيت ووصفه ليا بعد الجلسه مررررره رائع

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

تحدث الان