Dermazone StoreDermazone StoreDermazone Store

Coxir Intensive EGF Peptide Cream Mask Pack - 80 ml

ريال140.30

جميع الأسعار شاملة الضريبة

⦿ Deeply hydrates and locks in moisture for long-lasting softness
⦿ Reduces fine lines and wrinkles with peptides and collagen
⦿ Improves skin elasticity and strengthens the skin barrier
⦿ Gentle formula suitable for all skin types
⦿ Can be used as a wash-off or overnight mask

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

The Coxir Intensive Peptide Mask is designed to deeply hydrate and revitalize the skin. Infused with peptides, EGF, and collagen, this mask locks in moisture while encouraging healthy skin cell renewal. It helps to smooth fine lines and improve skin elasticity, making it suitable for all skin types, especially those needing extra hydration and support against signs of aging.

The mask strengthens the skin barrier, keeping it protected from dryness and pollutants, and can be used either as a wash-off mask or overnight treatment.

Product Details

  • Size: 80ml
  • Brand: Coxir
  • Country of Origin: Korea
  • Skin Type: All skin types

Key Benefits

  • Deeply hydrates and locks in moisture for long-lasting skin softness.
  • Helps reduce fine lines and wrinkles with peptides and collagen.
  • Improves skin elasticity and strengthens the skin barrier.
  • Gentle formula suitable for all skin types.
  • Can be used as an overnight mask or wash-off mask.

Key Ingredients

  • Peptides: Stimulate collagen production for firmer skin.
  • EGF (Epidermal Growth Factor): Helps activate skin renewal and fights signs of aging.
  • Collagen: Enhances skin elasticity and supports the creation of healthy cells.
  • Macadamia Seed Oil: Strengthens and protects the skin barrier.
  • Shea Butter: Provides deep hydration and nourishment.
  • Ginseng: Protects skin from free radicals and helps prevent premature aging.
  • Coconut Oil: Deeply moisturizes and nourishes the skin.
  • Cocoa Extract: Helps reduce signs of aging and maintains skin's radiance.
  • Ceramides: Boost hydration by retaining moisture in the deeper layers of the skin.

How to Use

  1. Cleanse your face thoroughly and apply toner.
  2. Spread a generous amount of the mask evenly across your face.
  3. Leave it on for 15-20 minutes, then rinse with warm water, or leave it on overnight and rinse in the morning.

Warnings

  • For external use only.
  • Avoid contact with eyes.
  • Keep out of reach of children.
  • Discontinue use if irritation occurs.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Intensive EGF Peptide Cream Mask Pack - 80 ml

ريال140.30
تحدث الان