Dermazone StoreDermazone StoreDermazone Store
0%

    Watermans Condition Me® 250ml - Hair Repair and Growth Conditioner

    ريال157.55

    جميع الأسعار شاملة الضريبة

    ⦿ Glossier looking hair
    ⦿ Freshens and softens the hair
    ⦿ Makes hair fuller and thicker
    ⦿ Revives and repairs damaged hair
    ⦿ Resists damage against hair heat-styling tools

    بيع بالكامل

    madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
    Order during to get it on hoursminutes
    Viewers are watching this product now

    Watermans Conditioner 250ml - For thicker and softer hair.

    Product Overview

    Repair, Revive, and Hydrate your Hair Faster with Watermans Special Conditioning Formula Packed Full of Vitamins and Minerals.

    Watermans Condition Me is an effective hair conditioner that gives hair a thicker, softer, and stronger look. It creates a deep moisturizing effect that hydrates and repairs dry and frizzy hair. 

    The conditioner consists of rich vitamins and ingredients including: 

    1. Cholesterol. 
    2. Shea Butter. 
    3. Niacinamide. 
    4. Olive Oil 
    5. Lupine Protein. 
    6. Caffeine 
    7. Rosemary

    Watermans' hair conditioner is a daily moisturizer and and can be used as a deep treatment conditioner. It works great against curly hair (Afro), as it enables it to grow stronger and thicker.

    Suitable for all hair types and ethnicities including: European, African, Asian, Latin and Middle Eastern hair. 

    Condition Me Key Benefits

    • Encourages Hair Growth.

    • Revitalizes hair appearance.

    • Stronger looking hair from root to tip.

    • Fuller & thicker looking hair.

    • Frizz control.

    • Added hair shine.

    • Repairs damaged hair from heat styling tools.

    Product Information 

    Ingredients

    Water, Glycerin, Cetearyl Alcohol, Shea Butter, Propylene Glycol, Cetrimonium Chloride, Behentrimonium Chloride, Phenoxyethanol, Polyquaternium-37, Cholesterol, Panthenol, Olea Europaea (olive Oil), Propylene Glycol Dicaprylate/Decaprylate, Phenyl Trimethicone, Fragrance, Extract Lupine Protein, Dimethicone, Hydroxyethylcellulose, Isopropyl Alcohol, PPG-1 Trideceth-6, Caffeine, Ethylhexylglycerin, Tetrasodium EDTA, Hexyl Cinnamal, Acrylates/Stearyl Methacrylate Copolymer, C10-11 Isoprafen, Linalool, Sorbitan Esters, Limonene, Rosemary Leaf Extract, Laureth-4, Laureth-23, Citric Acid, Salicylic Acid, Potassium Sorbate, Sodium Benzoate

    Product Details

    Bottle capacity: 250ml

    Brand: Watermans

    Made In: United Kingdom

    Age: 18+

    How to Achieve The Best Results

    To achieve the desired results from using the conditioner, we offer you two methods of use:

    1- For Regular use

    • Apply the conditioner after shampooing, and distribute it over the hair.
    • Massage hair from roots to ends, preferably using a comb.
    • Leave the conditioner for 2-3 minutes.
    • Rinse the hair with cold water

    2- For Deep Moisturizing Treatment

    • Apply the conditioner and distribute it all over the hair.
    • Cover the head with a towel or a plastic cap for bathing.
    • Leave the conditioner for 15-20 minutes.
    • Rinse the hair with cold water.

    Warnings

    • Do not rinse hair with very hot water.
    • Do not brush hair while it is wet and laden with water drops.
    • Do not leave conditioner on hair without rinsing it.
    • Don't forget to use a sulfate-free shampoo, such as Grow Me Shampoo.
    • Do not expose your hair to blow-dryers and dryers a lot.

    Return and refund policy:

    Reporting problems must be within 7 days of the order date.

    Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

    The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

    Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

    Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

    The refund from the company will be through the same method of payment by the customer.

    The estimated amount paid by the company shall be refunded within 7 to 21 working days.

    cancelling the order before processing and shipping can be done without incurring shipping costs.

    refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

    cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

    Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


    Customer Reviews

    Based on 81 reviews
    95%
    (77)
    4%
    (3)
    0%
    (0)
    0%
    (0)
    1%
    (1)
    S
    Serena Masoud
    اسوء خدمة

    للان ما استلمت الاوردر وبتواصل معكم على الواتساب ما احد يرد ليا شهر دافعه
    نصابين

    A
    A
    استخدمو كود الخصم Aa1991

    استخدمو كود الخصم Aa1991

    W
    Wasaif Abed

    كونديشن مي 250 مل - بلسم للشعر ترطيب و عناية مزدوجة

    ز
    زكيه السهلي

    كونديشن مي 250 مل - بلسم للشعر ترطيب و عناية مزدوجة

    N
    Nween Saad

    يجنن

    Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
    الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
    يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
    لا تتوفر عناصر كافية. بقي [max] فقط.
    Add to My WishlistBrowse my WishlistDelete from my Wishlist
    Shopping cart

    Your shopping cart is empty.

    Back to Shop

    Add notes to the order Edit notes
    Estimate shipping costs
    Add discount code

    Estimate shipping costs

    Add discount code

    The coupon code will work on the checkout page

    Watermans Condition Me® 250ml - Hair Repair and Growth Conditioner

    ريال157.55
    تحدث الان