Dermazone StoreDermazone StoreDermazone Store

Meille Organic Oil For Hair & Scalp - 59 ml

ريال78.00

جميع الأسعار شاملة الضريبة

⦿ Mielle oil contains more than 30 organic oils
⦿ Best moisturizer for hair and scalp
⦿ Reduces hair fall and improves thickness
⦿ For all hair types
⦿ The best results in short time
⦿ Healthier & shiny hair

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

This organic oil, made of the finest natural oils mixed together with biotin, provides effective hair care by stimulating hair growth, promoting scalp health and taking care of split ends.

Mielle oil is an effective product recommended by hair experts. It contains powerful oils that show excellent results within a short time.

This oil does not contain any harmful chemical such as parabens and perfumes.

This product contains both rosemary and peppermint oil, which stimulate blood circulation in the scalp, to increase the transfer of oxygen to the hair follicles, to have long, thick and strong hair.

This oil is classified as a daily hair care product to maintain hair, in addition to being used as a repair product that gets rid of damage, dryness, and loss to obtain healthy and shiny hair.

Product Details

Product size: 59.15 ml

Brand: Mielle Organics.

Made in: United States of America.

Instruction of Use

This oil can be used in several ways as follows.

  • To improve the scalp: Divide the hair into 4 parts and put a few drops of oil on the scalp, then massage gently for several minutes until the oil penetrates inside the scalp, and comb all over the hair, leave it for as long as you want.
  • For daily care: Apply a small amount of oil to the scalp and comb all over the hair.
  • For split ends care: Apply an appropriate amount of oil to the ends of the hair, cover the hair with a shower cap, then leave it on the hair for 10 minutes, then wash the hair with shampoo.

Ingredients

Soybean oil: It contains vitamins and fatty acids that penetrate deep into the hair to provide its growth, thickness and enhance its softness.

Castor oil: maintains scalp health, reduces itching and dandruff, and prevents hair loss.

Rosemary oil: provides new hair growth and prevents hair loss.

Jojoba oil: Rich in vitamins C, E, B and zinc, which moisturize the scalp and reduce hair loss.

Peppermint oil: stimulates blood circulation in the scalp, which strengthens the follicles and stimulates hair growth.

Tea Tree Oil: Moisturizes hair and gets rid of damage.

Coconut oil: preserves hair protein and protects it from split ends and damage.

Lavender oil: Produces hair growth to keep it healthy.

Wheat oil: Rich in vitamin B, which increases hair thickness.

Grapeseed oil: moisturizes the hair and keeps it shiny.

Sweet Almond Oil: Gets rid of dry hair and improves scalp health.

Why use Mielle Oil

  • It contains the most effective oils for hair problems.

  • Free of parabens and harmful chemicals.

  • 100% natural.

  • Gets rid of split ends and hair damage.

  • Moisturizes the scalp.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
خ
خلود الشمري
الرياض

جداً جميل ولكن العلبه صغيره

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Meille Organic Oil For Hair & Scalp - 59 ml

ريال78.00
تحدث الان