Dermazone StoreDermazone StoreDermazone Store

Ultra Hyaluronic Emulsion - 100 ml

ريال135.00

جميع الأسعار شاملة الضريبة

⦿ Hyaluronic emulsion to moisturize skin
⦿ A light, milky moisturizer that is highly absorbed into the skin
⦿ Maintains skin moisture and gets rid of dryness
⦿ All skin types
⦿ Best results after a short period of use
⦿ Contains best type of hyaluronic acid

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

This product combines hydration with a light texture that quickly absorbs into the skin without leaving any residue. One of its most important features is that it balances oils and skin moisture. It is also composed of high-quality natural ingredients, highly moisturizing hyaluronic acid, to maintain the level of moisture. In addition to reducing skin irritation and aging symptoms.


This light, milky moisturizer is suitable for day and night use, and can also be used as a primer before makeup.

Product Details

Product size: 100 ml

Brand: Coxir.

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Clean the skin very well.

  • Put a proper amount of Ultra Hyaluronic Toner on a piece of cotton and wipe the entire face with it. To enhance absorption into the skin.

  • Apply a proper amount of emulsion to the face and distribute it gently; For double hydration.

Ingredients

  • Allantoin: Soothes the skin, enhances its hydration, and improves the texture of the skin to make it smoother.

  • 19 Types Of Herbal Extracts: Very effective to soothe and moisturize the skin.

  • Hyaluronic Acid: A highly absorbent moisturizing substance that gets rid of wrinkles and fine lines.

Why Use Hyaluronic Emulsion

  • Very light and highly absorbent on the skin without making the skin feel oily.

  • Ultra-hydrating that goes into the skin deeply.

  • It contains the finest types of hyaluronic acid.

  • Free of any harsh ingredients, such as parabens.

Warnings

  • For external use only.

  • Avoid contact with eyes.

  • Keep out of reach of children.

  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 7 reviews
86%
(6)
0%
(0)
0%
(0)
14%
(1)
0%
(0)
l
lamya suliman

كوكسير مستحلب ألترا هيالورونيك

W
Wmq

رائع👍🏻

M
Manal Aljawi
جميل للبشرة

عجبني المنتج وترطيبه للبشرة

ر
رنا صابر

انا لين دحين ماشفت اي نتيجه ليا تقريبا ٢٠ يوم مستخدمتو

ب
بشرى القرني

كوكسير مستحلب ألترا هيالورونيك

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Ultra Hyaluronic Emulsion - 100 ml

ريال135.00
تحدث الان