Dermazone StoreDermazone StoreDermazone Store

Coxir Ultra Hyaluronic Acid Ampoule - 50 ml

ريال129.94

جميع الأسعار شاملة الضريبة

⦿ Deep Hydration: High concentration of hyaluronic acid for lasting moisture.
⦿ Nourishing: Contains collagen, vitamin B5, and centella asiatica for healthy skin.
⦿ Gentle on Skin: Suitable for all skin types, including sensitive skin.
⦿ Lightweight Texture: Quick-absorbing, non-sticky formula.
⦿ Chemical-Free: No parabens, fragrances, or alcohol.

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Hyaluronic Acid Ampoules

Product Overview

A lightweight water-based ampoule designed for deep hydration and skincare. Formulated with a high concentration of hyaluronic acid, collagen, vitamin B5, and 40% centella asiatica extract, this ampoule delivers maximum moisture, making it perfect for dry skin.

This product also contains natural ingredients that nourish the skin from within, helping to retain moisture for a healthier, more radiant complexion. Suitable for sensitive skin, it soothes irritation and reduces redness.

Product Details

  • Size: 50 ml
  • Brand: Coxir
  • Origin: Korea
  • Skin Type: Suitable for all skin types

How to Use

  1. Cleanse your skin thoroughly.
  2. Apply an adequate amount of the toner to a cotton pad and swipe across the face to enhance absorption.
  3. Dispense a suitable amount of the ampoule onto your face and gently massage for enhanced hydration.

Key Ingredients

  • Hyaluronic Acid: Provides immediate and deep hydration.
  • Aloe Vera Extract: Intensely hydrates and soothes the skin.
  • Hydrolyzed Collagen: Supports skin elasticity and health.
  • Centella Asiatica Extract: Effectively repairs and moisturizes while calming the skin and reducing fine lines and wrinkles.
  • Vitamin B5: Reduces dark spots, nourishes, hydrates, and improves skin elasticity.
  • Six Natural Plant Extracts: Calm the skin and strengthen its barrier while enhancing hydration.
  • Allantoin: Promotes skin healing and alleviates the effects of burns, cuts, and scars.

Benefits of Hyaluronic Acid Ampoules

  • Lightweight, water-based texture that leaves no sticky residue.
  • Soothes skin and reduces redness and irritation.
  • Provides deep hydration and repairs skin layers.
  • Free from parabens, fragrances, alcohol, and harsh chemicals.

Usage Warnings

  • For external use only.
  • Avoid contact with eyes.
  • Keep out of reach of children.
  • Discontinue use immediately if irritation occurs.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 4 reviews
75%
(3)
0%
(0)
25%
(1)
0%
(0)
0%
(0)
ل
لين الزغيبي
هيالورونيك

جيد لكن العلبة سيئة، المحلول يتسرب منها

A
Azizah Moh

كوكسير أمبولات ألترا هيالورونيك 50 مل

A
A.A.
Easy to use

Very easy and pleasant to use.

م
محمد علوي

كوكسير أمبولات ألترا هيالورونيك 50 مل

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Ultra Hyaluronic Acid Ampoule - 50 ml

ريال129.94
تحدث الان