Dermazone StoreDermazone StoreDermazone Store

Vancy's Favorites Bundle

ريال719.90

جميع الأسعار شاملة الضريبة

⦿ Vancy Favorites Bundle for hair, skin, nails and lips care
⦿ Growme Shampoo can help in hair thickness and reduce hair fall
⦿ Beauty Gummies enhance hair thickness and health, and reduce broken nails
⦿ River Glow Lip Tint can help you to have an attractive, glossy lips
⦿ Beauty Kit to take care of ladies beauty

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Bundle Overview

We offer for you in Vancy's Favorites Bundle a kit of effective products in caring for hair, skin, nails, and lips. Let us help you, my dear, to take care of your beauty from the inside out at all times, and this package includes all of the following.

1 Growme Shampoo - 250 ml

This shampoo contains a group of the most important vitamins that nourish hair, and many rich oils such as argan and rosemary oil, lupine protein and biotin in an advanced formula that helps reduce hair loss and enhances its hydration, density and shine.

How To Use
  • Use a small amount of shampoo on wet hair.

  • Gently massage the scalp.

  • Keep the shampoo on the hair and scalp for 3-4 minutes, then rinse it with lukewarm water.

  • Use shampoo 4-5 times a week; For best results.

1 Beauty Gummies - 60 piece

Rich in biotin and necessary vitamins for healthy hair, these gummies provide the necessary nutrition to stimulate hair growth and help strengthen follicles. To grow healthy, shiny hair with stronger thickness, it also improves skin health and helps strengthen nail health.

How To Use
  • Eat two Beauty Gummies either together or separately during the day.

  • Gummies can be taken at any time before or after food or during a meal.

  • It is recommended to use Beauty Gummies for two to three months; To get the best results.

3 River Glow Lip Tint  - 3 colors ( Tender Beach, Breeze fig, Hey Cherry)

This contains 3 moisturizing lip tint colors that do not cause chapping. To get full, shiny, attractive lips with an effectiveness that lasts for several hours and is suitable for daily use.

How To Use
  • Apply an appropriate amount of tint evenly on the lips.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Vancy's Favorites Bundle

ريال719.90
تحدث الان