Dermazone StoreDermazone StoreDermazone Store

CKD Amino Biotin Quick Black Shampoo Plus - 150g

ريال228.85

جميع الأسعار شاملة الضريبة

⦿ Enables easy hair coloring at home
⦿ Hydrates and soothes the scalp.
⦿ Covers hair from roots to ends in a natural black tone.
⦿ Rich in nourishing natural ingredients for hair health
⦿ Quick and effective in just three simple steps

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview:

Amino Biotin Quick Black Shampoo naturally covers white or gray hair in a rich black tone from roots to ends without the need for dye, completing the transformation in three easy steps and within a short time.

This shampoo is ideal for at-home hair coloring, designed to soothe and hydrate the scalp without irritation. Formulated with biotin, lecithin, 30% Centella Asiatica extract, and peppermint oil, it improves scalp health and is suitable for all hair types.

Product Details:

  • Size: 150g

  • Brand: CKD

  • Country of Origin: Korea

  • Hair Type: Suitable for all hair types

Ingredients:

  • Biotin: Nourishes hair follicles and supports hair growth.

  • Lecithin: Reduces hair loss and adds volume.

  • Centella Asiatica Extract: Soothes the scalp.

  • Peppermint Oil: Stimulates scalp circulation.

  • Salicylic Acid: Cleanses the scalp, removing impurities.

  • Panthenol: Hydrates the scalp.

  • Arginine: Boosts blood circulation and hair growth.

  • Soy Protein: Nourishes and strengthens hair.

How to Use:

  1. Wet hair and scalp thoroughly, then mix a sufficient amount of shampoo.

  2. Massage into hair and scalp, creating a rich lather. Leave for 3-5 minutes.

  3. Rinse hair thoroughly with water.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

CKD Amino Biotin Quick Black Shampoo Plus - 150g

ريال228.85
تحدث الان