Dermazone StoreDermazone StoreDermazone Store

The Ultimate Hair Growth Bundle

ريال1,048.80

جميع الأسعار شاملة الضريبة

⦿ Thickens, lengthens hair, and stops hair loss
⦿ Effective hair care routine
⦿ Stimulates hair growth and strengthens the roots
⦿ Doubles the rate of hair growth and adds volume
⦿ Effective for damaged or dyed hair
⦿ Activates the scalp and stimulates hair follicles

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

The Ultimate Hair Growth Bundle

Bundle Overview

2x Watermans Grow Me Shampoo

Grow Me is formulated with premium natural ingredients such as Caffeine, Biotin, Argan Oil, Niacinamide, Rosemary Extract, Allantoin, Hydrolyzed lupin protein, which all work in conjunction to stimulate hair growth.

1x Watermans Grow More Elixir

Grow More Elixir strengthens hair follicles through a natural scalp treatment. Grow more® scalp elixir is best applied daily directly to your scalp at night. Its effective formula features a blend of natural hair stimulating ingredients such as biotin, lupine protein, allantoin, panthenol, cottonseed protein, calcium, rosemary, and silica.

2x Beauty Gummies

Beauty Gummies combine biotin, antioxidants, vitamins, and caffeine. With only 2 gummies a day they provide it all – from supporting collagen production to maintaining a shiny head of hair. No artificial flavorings or food dyes and just 7.5 calories per gummy bear for a fresh and youthful look.

Benefits of this Bundle

All three products work effectively to prevent hair loss and stimulate hair growth.

Grow More Elixir

  1. Stimulates blood flow to the roots for more vibrant hair.

  2. Activates dormant hair follicles for stronger growth.

  3. Nourishes and prolongs hair.

Grow Me Shampoo

  1. Increases hair volume.

  2. Prevents hair loss.

  3. Sulfate-free, paraben-free.

Beauty Gummies

  1. Strengthens nails and protects them from breakage.

  2. Stimulates hair growth and makes it thicker.

  3. Stimulates the production of collagen necessary for the vitality and shine of hair and the health of nails.

Tips from Dermazone when using the Bundle

  • Stick to a hair care routine to get faster results.

  • Do not rinse off Grow More Serum instantly after applying.

  • Avoid hot water when taking a shower.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

The Ultimate Hair Growth Bundle

ريال1,048.80
تحدث الان