Dermazone StoreDermazone StoreDermazone Store

Watermans Protect Me 200ml - Heat Protection Spray For Hair

ريال169.05

جميع الأسعار شاملة الضريبة

⦿ Protects hair from the heat of styling tools
⦿ Promotes hair growth
⦿ Maintains hair moisture
⦿ Protects hair color
⦿ Prevents split ends and frizzy hair
⦿ Suitable for all hair types

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Heat Protection Spray with Hair Growth Technology - Moisturises hair and protects from heat styling tools

Product Overview

Protect Your Hair With Watermans Protect Me 

Protect Me Heat Protection Spray is an essential hair product; For its proven ability by experts to protect hair from blow-drying, and from the temperatures of styling tools such as a hair straightener. 

These tools can heat up to 230 degrees Celsius, which can damage the hair with repeated use, and lead to loss of moisture and vitality.

Key Benefits

Watermans' heat protection spray, is suitable for all hair types, as it is multi-use; In addition to protecting hair from heat it also: 

1. Prevents split ends and frizz.

2. Designed with a technology that promotes hair growth.

3. Hydrates the hair and retains its moisture. 

4. Nourishes and maintains a healthy color. 

Protect Me envelops the hair with a protective layer that creates a barrier against heat and stress from styling tools, which subsequently leads to dry, frizzy, split ends and brittle hair.

The product is safe as it is free from sulphates, parabens, and palm oil.

Product Information

Key ingredients

Rosemary: improves blood circulation in the scalp, nourishes the follicles, accelerates hair growth, and enhances its density.

Sunflower oil: Intensely moisturizes the hair, promotes its growth and density, in addition to softening the hair and making it appear healthy.

Caffeine: Stimulates hair growth, enhances blood flow to the scalp, and maintains hair moisture.

Vitamin B3: Stimulates blood circulation in the scalp, nourishes the follicles, and promotes rapid, healthy hair growth.

Lupine protein: Greatly nourishes the scalp and hair follicles; Because it contains a high percentage of protein.

Pro-vitamin B5: Enhances hair shine and density, increases hair strength and prevents hair loss.

Product Details

Pack capacity: 200ml.

Brand: Watermans

Age group: Adults.

Country of Origin: United Kingdom.

Skin type: All hair types.

Instructions for Use

1. Spray onto damp hair before blow-drying, 10 inches away.

2. Spray on hair before using any heat styler.

Warning: Avoid contact with eyes, if this occurs, rinse immediately with clean water.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Watermans Protect Me 200ml - Heat Protection Spray For Hair

ريال169.05
تحدث الان