Dermazone StoreDermazone StoreDermazone Store

Mom’s Bath Recipe Bundle For Dead Skin & Residue

ريال517.50

جميع الأسعار شاملة الضريبة

⦿ Removes dead skin cells and impurities effectively
⦿ Promotes smooth, hydrated, and radiant skin
⦿ Reduces blackheads and whiteheads while tightening pores
⦿ Provides natural exfoliation without causing irritation
⦿ Enhances absorption of skincare products with the included Gua Sha tool

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview:
This bundle is designed to tackle dead skin cells and impurities that cause acne, blemishes, and uneven skin texture. Featuring natural exfoliation and hydration, these products work gently without irritation. A Gua Sha massage tool is included as a free gift to enhance skin health and boost absorption of skincare products. The bundle includes:

  1. Mom’s Bath Exfoliating Body Mitt: Enriched with pineapple enzymes and fermented pumpkin extract to clear dead skin and impurities while soothing the skin.

  2. Mom’s Bath Body Milk (200ml): Provides instant hydration with Aqua Rock technology, leaving skin soft and refreshed without any sticky residue.

  3. Mom’s Bath Fruit Acid Cleansing Pads (60 pieces): Infused with salicylic acid to dissolve impurities, reduce blackheads and whiteheads, and tighten pores for smoother skin.

Product Details:

  • Brand: MOM'S BATH RECIPE

  • Origin: South Korea

  • Skin Type: Suitable for all skin types.

How to Use the Bundle:

  1. Use the Exfoliating Mitt to cleanse and exfoliate your body, then rinse thoroughly with water.

  2. Apply Body Milk to damp skin, massage gently, and rinse off.

  3. Pat your body dry with a towel.

  4. Use Fruit Acid Pads to wipe your face gently, focusing on blackhead-prone areas. Massage in the remaining product.

  5. Use the Gua Sha Tool to massage the face and body as per the provided instructions to improve circulation and absorption.

Usage Warnings:

  • Discontinue use if irritation occurs.

  • Test a small area of skin before full use to check for sensitivity.

  • Avoid using on damaged skin.

  • Store in a cool, dry place away from direct sunlight.

  • Keep out of reach of children.

  • Ensure the cleansing pad container is tightly sealed to prevent drying out.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Mom’s Bath Recipe Bundle For Dead Skin & Residue

ريال517.50
تحدث الان