Dermazone StoreDermazone StoreDermazone Store

I Dew Care Trust Bundle

ريال415.11

جميع الأسعار شاملة الضريبة

⦿ Instantly revives hair and enhances skin radiance
⦿ Compact and travel-friendly for on-the-go care
⦿ Deeply hydrates and nourishes lips with natural oils
⦿ Includes a versatile silicone brush for an enhanced skincare routine
⦿ Perfect for quick results before important events or while traveling.

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

The I Dew Care Trust Bundle offers three essential products for hair and skin care, along with a 2-in-1 silicone brush as a bonus. Designed for quick results, this bundle boosts confidence with instant improvements, making it ideal for last-minute events and travel. Compact and travel-friendly, it ensures your beauty routine is effortless and effective, wherever you go.

Included in the Bundle:

  1. Top Secret Box (2 Dry Shampoos):

    • Revives unwashed hair instantly with the power of black ginseng and charcoal powder to absorb oils and impurities.

    • Enriched with biotin to nourish hair, paired with a natural fiber comb to protect against breakage.

How to Use:

  • Apply 3–5 puffs of powder to the desired area, focusing on roots.

  • Massage with fingertips to distribute evenly and remove excess.

  • Style as needed.

  1. Mini Scoops Face Mask Set:

Travel-sized face masks to brighten, protect, and restore skin.

Includes:

  • Cake My Day Mask: Locks in moisture and revitalizes skin with hyaluronic acid and squalane.

  • Matcha Mood Mask: Instantly soothes and protects with aloe, matcha, and green tea extracts.

  • Berry Groovy Mask: Antioxidant-rich to reduce dark spots and enhance radiance.

How to Use:

  • Use a headband to keep hair away.

  • Apply an even layer of the mask to cleansed skin, avoiding eyes and lips.

  • Leave on for 5–10 minutes.

  • Gently massage while rinsing off with water.

  • Use 2–3 times weekly.

  1. Grape Lip Oil (6ml):

    • Infused with natural oils and vitamins to deeply nourish lips and provide long-lasting hydration.

How to Use:

  • Apply evenly to lips.

  • Reapply as needed for softness and shine.

  1. 2-in-1 Silicone Brush (Gift):

    • A versatile tool to enhance your skincare routine.

    • Use the flat side to evenly distribute products, and the textured side for deep cleansing or removing skincare residue.

How to Use:

  • Use the flat side for even application of skincare products.

  • Use the textured side to massage, cleanse, or remove residue.

  • Rinse thoroughly with water after each use.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

I Dew Care Trust Bundle

ريال415.11
تحدث الان