Dermazone StoreDermazone StoreDermazone Store

Watermans 3 Months Hair Growth Bundle

ريال1,070.65

جميع الأسعار شاملة الضريبة

⦿ Lengthens hair and stop hair loss
⦿ Doubles the rate of hair growth and increase its volume
⦿ Revitalizes dormant hair follicles

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now
Details

Watermans 3 Months Hair Growth Bundle 

Bundle Overview

  1. 3x Grow Me Shampoo: Grow Me is formulated with premium natural ingredients such as Biotin, Caffeine, Argan Oil, Rosemary Extract, Niacinamide, Allantoin, Hydrolyzed lupin protein, all working in conjunction to make your scalp stimulate hair growth.

  2. 2x Grow More Elixir: Elixir follicle strengthening and scalp treatment and a revolutionary serum that nourishes the roots of the hair.

Benefits of this Bundle

  • 3 months treatment course that stops hair loss.

  • This package stimulates hair growth, strengthens roots, and doubles growth.

  • Treats damage caused by exposing hair to heat and chemicals.

  • Activates hair follicles and makes them enter the phase of stimulation and growth.

  • Products free from sulfates and parabens.

  • Fortified with caffeine, vitamins and antioxidants.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Watermans 3 Months Hair Growth Bundle

ريال1,070.65
تحدث الان