Dermazone StoreDermazone StoreDermazone Store

I Dew Care Thirst Things First Vitamin C Facial Mist - 80ml

ريال122.26

جميع الأسعار شاملة الضريبة

⦿ Instantly refreshes and revitalizes the skin.
⦿ Maintains hydration throughout the day
⦿ Leaves no residue or stickiness on the skin
⦿ Brightens skin tone with regular use
⦿ Protects against dryness caused by environmental stressors

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview:

The Thirst Things First Vitamin C Facial Mist instantly refreshes and hydrates the skin throughout the day. This dual-phase mist combines an oil and water formula that leaves no residue, providing a burst of antioxidants to revitalize the skin and protect it from dryness caused by environmental stressors.

Product Details:

  • Size: 80ml

  • Brand: I Dew Care

  • Country of Origin: Korea

  • Skin Type: Suitable for all skin types

Ingredients:

  • Vitamin C: Supports skin renewal and brightens complexion.

  • Lemon Peel Extract: Retains skin moisture.

  • Apple Seed Oil: Activates and deeply hydrates the skin.

  • Pomegranate Extract: Provides antioxidant protection and revitalization.

How to Use:

  1. Shake the bottle well before use to mix the oil and water formula.

  2. Close your eyes and spray evenly on your face and neck daily.

Usage Warnings:

  • Stop use immediately if any allergic reactions occur.

  • Consult a doctor if symptoms worsen.

  • Avoid direct sunlight and contact with eyes.

  • Keep out of reach of children.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

I Dew Care Thirst Things First Vitamin C Facial Mist - 80ml

ريال122.26
تحدث الان