Dermazone StoreDermazone StoreDermazone Store

Coxir Black Snail Collagen Emulsion - 100 ml

ريال142.34

جميع الأسعار شاملة الضريبة

⦿ Black snail collagen emulsion for skin lifting
⦿ Deep and high moisturizing
⦿ Deep protection of aging signs
⦿ All skin types
⦿ Enhance skin elasticity
⦿ Get flawless skin

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

Black snail collagen emulsion is one of the best skin care products. It has a light, milky texture that is highly absorbent, to provide the necessary nutrition for the skin.


This product effectively tightens and moisturizes the skin; It is rich in collagen and hyaluronic acid, with many other natural ingredients that have proven effective in skin care.


This Korean emulsion is free of all irritants and harsh ingredients on the skin, such as alcohol and parabens. Therefore, it is safe for use by all skin types.

Product Details

Product size: 100 ml

Brand: Coxir.

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Clean the face well with cleanser.

  • Use a Coxir collagen toner by placing some of it on a cotton ball and wiping the entire face and neck.

  • Use an appropriate amount of emulsion and spread it all over the face with gentle massage.

  • Apply it on the face to absorb it completely.

Ingredients

Black Snail Collagen: Maintains skin moisture and protects it from dryness, in addition to effectively improving skin elasticity.

Black Sesame Extract: Improves the appearance of the skin, gets rid of the effects of sunburn, and protects the skin from harmful environmental factors and fungi that cause many skin infections.

Adenosine: Soothes and repairs the skin, improving its health and texture.

Natural Collagen: Provides deep hydration to the skin, prevents the appearance of fine lines and improves its texture.

Black Bean Extract: Effectively nourishes the skin because it contains vitamins and minerals that strengthen the skin barrier.

Peptide: Prevent the symptoms of aging and soothe skin redness and irritation.

Hyaluronic: Moisturizes the deep layers of the skin and gets rid of fine lines.

Why Use Black Snail Collagen Emulsion

  • Light texture that is quickly absorbed by the skin.

  • Tighten the skin to look more youthful.

  • Combines hydration and prevention of signs of aging.

  • Free of parabens, alcohol, and all harsh substances on the skin.

Warnings

  • For external use only.

  • Avoid contact with eyes.

  • Keep out of reach of children.

  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 6 reviews
50%
(3)
33%
(2)
17%
(1)
0%
(0)
0%
(0)
ا
اماني العتيبي

كوكسير مستحلب كولاجين الحلزون الأسود

س
سيف العنزي

كوكسير مستحلب كولاجين الحلزون الأسود

ف
فاطمة علي
My rating

Very wonderful products and I want to buy them constantly, but they are so expensive that I was not able to buy them except with a discount %50💔

M
Maryam Aljizani

كوكسير مستحلب كولاجين الحلزون الأسود

ر
رهف الغامدي

كوكسير مستحلب كولاجين الحلزون الأسود

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Black Snail Collagen Emulsion - 100 ml

ريال142.34
Chat now