Dermazone StoreDermazone StoreDermazone Store

Hair Care Bundle for Dry Hair

ريال1,124.70

جميع الأسعار شاملة الضريبة

⦿ Moisturizing and nourishing conditioner
⦿ Sulfate-free formula for dry hair treatment
⦿ Maintains hair shine and vitality
⦿ Rejuvenates the hair
⦿ Detangles hair knots and makes it easier to style

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now
Details

The Hair Care Bundle for Dry Hair

Bundle Overview

2x Grow Me Shampoo

Grow Me contains Vitamins and antioxidants such as H, B7, B3, B6, C, E, calcium pantothenate that converts into Vitamin B5 to moisturize the scalp, Pyridoxine (Vitamin B6) is essential for normal skin metabolism and beneficial protective effects on the scalp and strengthen the hair.

Grow Me is formulated with premium natural ingredients such as Caffeine, Biotin, Argan Oil, Niacinamide, Rosemary Extract, Allantoin, Hydrolyzed lupin protein, which all work in conjunction to make your scalp the optimal place for hair growth.

1x Conditioner

Watermans Condition Me has a cholesterol infused formula that helps your hair feel stronger. The Cholesterol comes from Lanolin which is from sheep's wool, this is known to have antifungal and anti-bacterial properties that protect the skin from infection.

2x Beauty Gummies

Beauty Gummies combine biotin, vitamins, antioxidants and caffeine. With only 2 gummies a day they provide it all – from supporting collagen production to maintaining a shiny head of hair. No artificial flavorings or food dyes and just 7.5 calories per gummy bear for a fresh and youthful look.

Benefits of this Bundle

Along with Grow Me Shampoo and Beauty Gummies, Condition Me makes the perfect combination to help you treat your dry hair, stop hair loss, and grow thicker and stronger looking hair from root to the tip.

Condition Me Conditioner

  1. Revitalizes hair appearance.

  2. Stronger looking hair from root to tip.

  3. Fuller & thicker-looking hair.

Grow Me Shampoo:

  1. Increases hair volume.

  2. Sulfate-free, paraben-free.

  3. Prevents hair loss.

Beauty Gummies:


  1. Stimulates hair growth and makes it thicker.

  2. Strengthens nails and protects them.

  3. Stimulates the production of collagen in the skin.

Tips from Dermazone

  • Use the product in the bundle as part of your hair care routine.

  • Start with regular massaging of the scalp.

  • Using some essential oils to massage the scalp.

  • Avoid hot water when taking a shower.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 23 reviews
87%
(20)
4%
(1)
9%
(2)
0%
(0)
0%
(0)
د
ديرمازون
كود خصم

لاتنسو تستخدمو كود الخصم Aa1991

ع
عبير فارس
روووعه

ايجننن

T
Tahani Alyami
اكثر من رائعة

اخذت الكوريس حق الثلاث شهور من كثر ما اسمع مدح عليها قلت اجربها وكلي ثقة اني راح استفيد منها

م
محمد البقمي

باقة الشعر الأقوى للشعر الجاف

ن
نورة العقيل

باقة الشعر الأقوى للشعر الجاف

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Hair Care Bundle for Dry Hair

ريال1,124.70
تحدث الان