Dermazone StoreDermazone StoreDermazone Store

Extreme Weight Loss Package | PGX Daily & Vita Lite

ريال853.47

جميع الأسعار شاملة الضريبة

⦿ PGX helps suppress the appetite
⦿ Vita Lite helps in burning fat
⦿ PGX reduces the number of meals throughout the day
⦿ Vita Lite improves digestive health
⦿ PGX and Vita Lite regulate blood sugar and cholesterol levels
⦿ Vita Lite gets rid of all toxins in the body

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Package Contents

3 packs of PGX Daily - 30 sachets per box

PGX enhances the feeling of fullness and thus reduces the food consumption and helps in weight loss; It is a drink consisting of natural, high-viscosity protein complex fibers that extend in the stomach for more than 30 minutes and slow down the digestion process, thus reducing the desire to eat throughout the day.

How to use

Twice daily, empty the content of the sachet with any liquid or soft substance such as yogurt, orange juice or water half an hour before eating the main meal.

Tips when using PGX

  • Drink an extra glass of water after eating it.
  • Have it from yogurt, juice or soup instead of water.
  • Reducing the amount of the product after two weeks if you do not feel comfortable.
  • Consult a doctor if taking other medications, and take the medication one hour before and two hours after.
  • Adopting a healthy weight loss system based on reducing food and staying away from harsh regimes.

1 Packet Of Vita Lite Gummies - 90 Pieces

Vita Lite Gummies are composed of apple cider vinegar extract that effectively breaks down triglycerides, and it also gets rid of harmful toxins that increase weight.

How to use

Eat 1 or 2 Vita Light Gummies daily.

This package supports weight loss in a healthy and effective way without any side effects. To help you reach the desired weight without any deprivation.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Extreme Weight Loss Package | PGX Daily & Vita Lite

ريال853.47
تحدث الان