Dermazone StoreDermazone StoreDermazone Store

Shiseido - Tsubaki Premium EX Repair Hair (180g)

ريال108.00

جميع الأسعار شاملة الضريبة

⦿ Rich in Tsubaki oil for intense nourishment and repair
⦿ Infused with pearl protein to reduce frizz and boost shine
⦿ Quick application, no waiting time required
⦿ Deep hydration with hyaluronic acid and royal jelly extract
⦿ Suitable for all hair types, especially damaged hair

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Tsubaki Hair Repair Mask

Product Overview

The Tsubaki Premium EX Repair Hair Mask from Shiseido is a powerful treatment designed to repair damaged hair from root to tip. It restores lost moisture and protein, protects against heat styling tools, and environmental damage. Utilizing advanced technology, the mask deeply penetrates the hair shaft to repair each strand individually, creating a protective shield for healthier, shinier hair.

Enriched with camellia oil (Tsubaki), the mask delivers deep hydration and repairs damaged hair roots, thanks to essential fatty acids like Omega-3. It also contains ionic repair elements such as Laurtrimonium Chloride, pearl protein (Conchiolin), hyaluronic acid, and royal jelly extract, helping combat dryness and frizz.

Hair experts favor the Tsubaki mask for its ease of use. The formulation penetrates instantly, allowing you to rinse your hair within seconds, saving time and money on expensive salon treatments.

Product Details

  • Size: 180g
  • Brand: Shiseido
  • Country of Origin: Japan
  • Hair Type: All hair types, especially damaged and dry hair

Usage Instructions

  1. Wash hair thoroughly with shampoo and rinse gently.
  2. Apply an appropriate amount of the mask to the entire hair, focusing on damaged areas.
  3. You can rinse immediately or leave it on until the end of your shower routine.
  4. Use 1-2 times a week for best results.

Key Ingredients

  • Tsubaki Oil (Camellia Oil): Rich in essential amino acids to nourish, hydrate, and repair hair damage.
  • Pearl Protein: Helps reduce frizz, repair damage, and enhance shine.
  • Hyaluronic Acid: Deeply hydrates hair from root to tip.
  • Royal Jelly Extract: Nourishes the hair and locks in moisture.

Key Benefits

  • Repairs damaged hair.
  • Provides deep hydration and enhances shine.
  • Locks in moisture, reducing dryness.
  • Minimizes frizz and enhances smoothness.
  • Quick and easy application for instant results.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Shiseido - Tsubaki Premium EX Repair Hair (180g)

ريال108.00
تحدث الان