Dermazone StoreDermazone StoreDermazone Store

Coxir Black Snail Collagen Serum - 50 ml

ريال128.99

جميع الأسعار شاملة الضريبة

⦿ Black snail collagen serum to get rid of skin damage
⦿ Repairing the skin
⦿ Get rid of fine lines
⦿ All skin types
⦿ Enhance skin glow during a short time
⦿ To have a flawless skin free of wrinkles

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

Black Snail Collagen serum is one of the powerful and effective skin care products in getting rid of many skin problems. Therefore, we chose for you a black snail collagen serum that is rich in natural ingredients that is proven it’s effective by experts and users.


This skin repair and dehydration serum contains nutrient-rich black snail collagen serum; It tightens the skin and improves its elasticity to make it appear fresh and fuller. It also reduces fine lines and wrinkles. Therefore, it is recommended for those with damaged, dry and aging skin.

Product Details

Product size: 50 ml

Brand: Coxir.

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Clean the face well with cleanser.

  • Use a Coxir collagen toner by placing some of it on cotton and wiping the entire face and neck.

  • Use an appropriate amount of serum on the palm of the hand and distribute it gently throughout the face.

  • Massage the face to absorb it completely.

Ingredients

  • Black Snail Collagen: Maintains skin moisture and protects it from dryness, also it’s effective by improving skin elasticity.

  • Black Bean Extract: Contains nourishing vitamins and minerals that strengthen the skin barrier and give it a healthy look.

  • Natural Collagen: Provides deep hydration to the skin, prevents the appearance of fine lines and improves its texture.

  • Allantoin: Soothes the skin, enhances its hydration, and improves the texture of the skin to make it smoother.

  • Peptide: Prevents signs of aging and tightens the skin.

  • Ginseng plant: Contains antioxidants that repair skin cells.

Why Use Black Snail Collagen Serum

  • An effective serum in nourishing and moisturizing the skin.

  • Tightens the skin effectively.

  • Getting rid of signs of aging.

  • Rich in black snail collagen that nourishes the skin.

  • Rejuvenate the skin and get rid of damage.

Warnings

  • For external use only.

  • Avoid contact with eyes.

  • Keep out of reach of children.

  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Black Snail Collagen Serum - 50 ml

ريال128.99
تحدث الان