Dermazone StoreDermazone StoreDermazone Store

CKD Retino Collagen Small Molecule 300 Pore & Elasticity Mask (1EA) - 31ml

ريال35.67

جميع الأسعار شاملة الضريبة

⦿ Hydrates and nourishes the skin without causing dryness
⦿ Reduces visible signs of aging significantly
⦿ Improves skin softness and texture
⦿ Supports collagen production for firmer skin
⦿ Hydrates and nourishes the skin without causing dryness

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview:

This creamy mask offers powerful skin-tightening properties and reduces signs of aging. It has a unique creamy texture that is left on the skin for 30-40 minutes until it dries, after which it is peeled off. The mask helps maintain skin hydration and provides nourishing elements without causing dryness.

The mask contains 73% molecular collagen extract, which tightens sagging skin, and a blend of retinol, allantoin, arginine, hydrolyzed collagen, hyaluronic acid, elastin, and several natural oils that work together to improve collagen production and maintain its level in the skin.

Product Details:

  • Size: 31ml

  • Brand: CKD

  • Country of Origin: Korea

  • Skin Type: Suitable for all skin types

Ingredients:

  • Hydrolyzed Collagen: Supports skin tightening and reduces signs of aging.

  • Retinol: Helps regenerate skin cells and reduces fine lines.

  • Hyaluronic Acid: Maintains collagen levels in the skin.

  • Elastin: Improves skin texture.

  • Ceramides: Strengthens the natural skin barrier.

  • Turmeric Root Extract: Fights skin damage causes.

  • Allantoin: Prevents dryness and skin irritation.

  • Arginine: Supports skin health and wound healing.

  • Sunflower Oil: Protects the skin from free radicals.

  • Safflower Oil: Enhances skin softening and hydration.

  • Argan Oil: Fights wrinkles and pigmentation.

  • Camellia Oil: Protects the skin from UV rays.

How to Use:

  1. Cleanse the skin thoroughly.

  2. Apply a sufficient amount evenly on the dry face, avoiding the eye, eyebrow, and lip areas.

  3. Wait for 30-40 minutes until the mask becomes transparent, then peel it off from bottom to top, starting from the edges.

  4. Gently tap the remaining mask residue on the face to enhance absorption.

Note: Drying time may vary depending on skin type and the amount applied.


Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

CKD Retino Collagen Small Molecule 300 Pore & Elasticity Mask (1EA) - 31ml

ريال35.67
تحدث الان