Dermazone StoreDermazone StoreDermazone Store

Coxir EGF Peptide Cream 50 ml

ريال148.35

جميع الأسعار شاملة الضريبة

⦿ Rich in peptides and EGF to regenerate skin cells and reduce wrinkles
⦿ Provides deep hydration and nourishment for dry and damaged skin
⦿ Improves skin elasticity and firms the skin overnight
⦿ Light, non-greasy formula suitable for all skin types
⦿ Free from harsh ingredients such as fragrances and parabens

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

Coxir Peptide Cream is designed to support your skin's natural repair process overnight. With a blend of peptides, EGF, and collagen, this cream helps reduce fine lines and wrinkles while providing deep hydration. It's particularly suited for dry, damaged, and aging skin.

This lightweight formula is easily absorbed and won’t leave a greasy residue, making it suitable for all skin types. Free from parabens and fragrances, it’s gentle on sensitive skin as well.

Product Details

Size: 50ml

Brand: Coxir

Country of Origin: Korea

Skin Type: Suitable for all skin types, especially dry and damaged skin

Key Benefits

Reduces the appearance of fine lines and wrinkles.

Provides long-lasting hydration for dry and damaged skin.

Supports skin regeneration overnight with ingredients like peptides and EGF.

Lightweight and suitable for all skin types.

Formulated without parabens or fragrances.

Key Ingredients

EGF (Epidermal Growth Factor): Promotes cell regeneration and collagen production, helping to prevent fine lines and wrinkles.

Peptides: Stimulate collagen production and improve skin elasticity.

Collagen: Firms the skin and reduces the appearance of wrinkles.

Panthenol: Deeply hydrates and enhances skin elasticity.

Niacinamide: Brightens the skin and helps reduce signs of aging.

How to Use

After cleansing, apply a small amount to your face and neck as the final step in your night routine. Gently pat the skin to enhance absorption.

Warnings

For external use only.

Avoid contact with eyes.

Keep out of reach of children.

Discontinue use if irritation occurs.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir EGF Peptide Cream 50 ml

ريال148.35
تحدث الان